Message boards : Number crunching : Computation errors with BOINC 7.0.25 (WinXP 32 bit)
Author | Message |
---|---|
vdquang Send message Joined: 29 Sep 06 Posts: 11 Credit: 1,643,444 RAC: 331 |
I have just updated to BOINC ver. 7.0.25. However, computation errors happened with all 7 work units (6 out of them were newly downloaded ones since the update). Should I revert to the old version 6.12.34? |
Mod.Sense Volunteer moderator Send message Joined: 22 Aug 06 Posts: 4018 Credit: 0 RAC: 0 |
It looks as though there must be some problem work units out there. As your failures were reported, the tasks were reissued to other machines and failed there as well under various BOINC versions. Is anyone else having problems with task names starting with "rb_04_12" & "rb_04_13"?? Rosetta Moderator: Mod.Sense |
BobbyG Send message Joined: 6 Mar 06 Posts: 4 Credit: 711,077 RAC: 0 |
It looks as though there must be some problem work units out there. As your failures were reported, the tasks were reissued to other machines and failed there as well under various BOINC versions. I have been getting several computation errors since I installed Boinc 7.0.25 x(64). The latest starts with aa_centroid_cst. |
Around Send message Joined: 16 Oct 11 Posts: 3 Credit: 474,717 RAC: 0 |
I am experiencing the same issue with 7.0.25 (x64). Of my most recent 84 tasks, 66 have computation errors with only 18 successes. Cheers, Adrian |
Wayne Miller Send message Joined: 10 Feb 06 Posts: 5 Credit: 141,581 RAC: 50 |
I too can verify that since upgrading to Boinc 7.0.25 (x64) most of my work units have computation errors. |
Rick Send message Joined: 29 Mar 12 Posts: 1 Credit: 85,917 RAC: 0 |
I have been having the same problem with BOINC 7.0.25 (WinXP 64 bit). Any ideas on a fix? |
Fi and Charlie Shaw Send message Joined: 7 May 07 Posts: 8 Credit: 346,961 RAC: 0 |
I'm crunching Rosetta on a 32bit machine, so I don't think the 64 bit argument below can be valid. Yesterday 27/4/2012 I was getting more and more client errors using BOINC 7.0.025. In frustration I stopped my crunching with Rosetta and replaced BOINC with version 6.12.34 which can still be downloaded from the BOINC website. Since then, I have had no client errors. So on conclusion, something seems amiss with BOINC 7.0.25 and Rosetta. My other 2 64bit computers are crunching other projects seperatley and are not experiencing any issues with BOINC 7.0.25 yet ! Its a temporary solution, in my case, and I hope it helps others, until the situation is resolved. Swordfish ps apologies to moderators for posting originally in wrong thread |
![]() ![]() Send message Joined: 30 May 06 Posts: 5756 Credit: 6,051,728 RAC: 373 |
Since BOINC 7 has come out there have been some people that are having issues with tasks erroring out or running high priority all the time and grabbing all the cores in the process. On another project someone has posted this issue on the BOINC error board and has heard back that BOINC will put the fix in the next version, whenever that is. So you might as well stay with Version 6 for now until the next version of BOINC comes out. |
kislov Send message Joined: 26 May 11 Posts: 1 Credit: 71,293 RAC: 0 |
Same here ! Just installed the latest version of BOINC, and most of the tasks from Rosetta end up with Computation Error, with is not the case with other projects: Milkyway, Einstein, Orbit, SETI, Cosmology - they have no errors at all. I run Win7 64 bit. |
![]() ![]() Send message Joined: 30 May 06 Posts: 5756 Credit: 6,051,728 RAC: 373 |
Same here ! Just installed the latest version of BOINC, and most of the tasks from Rosetta end up with Computation Error, with is not the case with other projects: Milkyway, Einstein, Orbit, SETI, Cosmology - they have no errors at all. Just set your projects to no new work. Finish what you have and then go back to version 6 if you want to keep running all projects without errors. |
mikey![]() Send message Joined: 5 Jan 06 Posts: 1897 Credit: 12,222,169 RAC: 22,219 ![]() |
Same here ! Just installed the latest version of BOINC, and most of the tasks from Rosetta end up with Computation Error, with is not the case with other projects: Milkyway, Einstein, Orbit, SETI, Cosmology - they have no errors at all. Rosetta has a known problem with the version 7 series of Boinc, stop using it or find another project until they fix it is my suggestion. |
![]() Send message Joined: 4 Oct 05 Posts: 13 Credit: 1,272,625 RAC: 6 |
Get it as regular as clock work. It turns out to be a missing file (usually .ini) so although the wu has been completed it cant wright to the .ini file as the address quoted is not their it is in another file or folder address or in deed missing altogether. |
![]() ![]() Send message Joined: 9 May 10 Posts: 1 Credit: 5,017,544 RAC: 8,229 ![]() |
I was getting errors on 7.0.25 and then 7.0.26, but I have since changed to 7.0.27 and things are much better. gone from about 50% error to about 2 in two days. I also switched Rosetta preferences to 1hr/WU. On the errors left, it seems to be happening after 'Setting up graphics native' ... Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev48292.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3 ERROR: core::util::switch_to_residue_type_set fails ERROR:: Exit from: ......srccoreutilSwitchResidueTypeSet.cc line: 143 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish </stderr_txt> Using on both computers: Phenom IIs Windows 7 64 AMD HD5870 on one shrubbing MilkyWay, HD5770 on another shrubbing POEM. Just my observations. |
Fi and Charlie Shaw Send message Joined: 7 May 07 Posts: 8 Credit: 346,961 RAC: 0 |
I've just gone back to version 7.026 and I'm getting errors again. As i'm not prepared to waste anymore valuable computing time on unpredictable results, I've detatched from the project until matters are resolved. Yes I could go back to version 6.xxx as I did do earlier in this thread, but I'm not faffing around anymore. I dont have any problems with Seti, on all 3 of my machines running 7.026, and that where I will stay until this is sorted. Swordfish |
Charles Tomaras Send message Joined: 18 Aug 09 Posts: 11 Credit: 30,541,675 RAC: 38,562 ![]() |
I'm having about a 2/3'rd failure rate on ALL my Rosetta work units since the 7.0.25 Boinc update. Reports back Client Error and Compute Error. This version of Boinc and my CPU are fine with SETI work units on all cores so I think the problem is specific to the Rosetta project and this latest update. Is this on the radar? Is a fix at hand? Here's what's reported from my most recent failed work unit: 509376616 Name jsr_decoys_centroid_2oss_SAVE_ALL_OUT_50596_640_0 Workunit 464057852 Created 30 May 2012 6:00:33 UTC Sent 30 May 2012 6:01:11 UTC Received 30 May 2012 19:41:14 UTC Server state Over Outcome Client error Client state Compute error Exit status 1 (0x1) Computer ID 1488309 Report deadline 9 Jun 2012 6:01:11 UTC CPU time 6682.552 stderr out <core_client_version>7.0.25</core_client_version> <![CDATA[ <message> Incorrect function. (0x1) - exit code 1 (0x1) </message> <stderr_txt> [2012- 5-30 10:14:10:] :: BOINC:: Initializing ... ok. [2012- 5-30 10:14:10:] :: BOINC :: boinc_init() BOINC:: Setting up shared resources ... ok. BOINC:: Setting up semaphores ... ok. BOINC:: Updating status ... ok. BOINC:: Registering timer callback... ok. BOINC:: Worker initialized successfully. Registering options.. Registered extra options. Initializing broker options ... Registered extra options. Initializing core... Initializing options.... ok Options::initialize() Options::adding_options() Options::initialize() Check specs. Options::initialize() End reached Loaded options.... ok Processed options.... ok Initializing random generators... ok Initialization complete. Initializing options.... ok Options::initialize() Options::adding_options() Options::initialize() Check specs. Options::initialize() End reached Loaded options.... ok Processed options.... ok Initializing random generators... ok Initialization complete. Setting WU description ... Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev48292.zip Unpacking WU data ... Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/2oss_homfrags.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... Setting up folding (abrelax) ... Beginning folding (abrelax) ... BOINC:: Worker startup. Starting watchdog... Watchdog active. Starting work on structure: _00001 Starting work on structure: _00002 Starting work on structure: _00003 Starting work on structure: _00004 Starting work on structure: _00005 Starting work on structure: _00006 Starting work on structure: _00007 Starting work on structure: _00008 Starting work on structure: _00009 Starting work on structure: _00010 Starting work on structure: _00011 </stderr_txt> ]]> Validate state Invalid Claimed credit 68.5895906965126 Granted credit 0 application version 3.31 |
mikey![]() Send message Joined: 5 Jan 06 Posts: 1897 Credit: 12,222,169 RAC: 22,219 ![]() |
I'm having about a 2/3'rd failure rate on ALL my Rosetta work units since the 7.0.25 Boinc update. Reports back Client Error and Compute Error. This version of Boinc and my CPU are fine with SETI work units on all cores so I think the problem is specific to the Rosetta project and this latest update. Is this on the radar? Is a fix at hand? NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result. |
Old man Send message Joined: 10 Nov 07 Posts: 26 Credit: 2,307,025 RAC: 899 ![]() |
I'm having about a 2/3'rd failure rate on ALL my Rosetta work units since the 7.0.25 Boinc update. Reports back Client Error and Compute Error. This version of Boinc and my CPU are fine with SETI work units on all cores so I think the problem is specific to the Rosetta project and this latest update. Is this on the radar? Is a fix at hand? But...i have 7.0.25 boinc version on my win 7 machine. I run now rosetta and all working fine. What i have done wrong because all working fine? |
Mod.Sense Volunteer moderator Send message Joined: 22 Aug 06 Posts: 4018 Credit: 0 RAC: 0 |
NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result. I should point out that mikey is speaking for himself and not for Rosetta@home. Mikey's comments are based on observation, without knowledge of the project's intentions. Rosetta Moderator: Mod.Sense |
mikey![]() Send message Joined: 5 Jan 06 Posts: 1897 Credit: 12,222,169 RAC: 22,219 ![]() |
NO...Rosetta does NOT support the Version 7 series of Boinc and has NO PLANS to change anything! They are quite happy with how things are going right now. Many of us have moved on to other projects as a result. You are more than welcome to say that but the Admin Michael said the same thing in one of his messages! Now it could be he has no clue either but one would think an Admin posting as an Admin would be responsible! |
![]() Send message Joined: 17 Sep 10 Posts: 3 Credit: 1,291,154 RAC: 0 |
guys, same here, since update i been getting lots of troubles!!, 90% of my tasks finish with computer errors!! :( u can see it here: https://boinc.bakerlab.org/rosetta/results.php?hostid=1531171 with my others pc with older versions of boinc its working great. is there any admin information why this isnt working fine??, should i change proyect or dowload older version?... btw... where i can get an older version of boinc ? thanks! |
Message boards :
Number crunching :
Computation errors with BOINC 7.0.25 (WinXP 32 bit)
©2025 University of Washington
https://www.bakerlab.org