Message boards : Number crunching : Minirosetta 3.20
| Author | Message |
|---|---|
robertmilesSend message Joined: 16 Jun 08 Posts: 1264 Credit: 14,421,737 RAC: 0 |
Nobody else has created a thread for the new minirosetta 3.20, so I'm creating one. I've already read that 3.20 is supposed to fix the graphics problem in 3.19. |
|
Rocco Moretti Send message Joined: 18 May 10 Posts: 66 Credit: 585,745 RAC: 0 |
I've already read that 3.20 is supposed to fix the graphics problem in 3.19. Confirmed - 3.20 should fix the graphics issues seen with 3.19. If you're still encountering problems, please let us know in this thread. |
|
Etienne Guyot Send message Joined: 27 Oct 05 Posts: 10 Credit: 954,962 RAC: 0 |
|
[VENETO] bobovizSend message Joined: 1 Dec 05 Posts: 2172 Credit: 13,247,810 RAC: 7,905 |
476915389 Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev46858.zip Unpacking WU data ... Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/T0586_boinc_cm_test_abinitio_cmiles.boinc.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... Setting up folding (abrelax) ... ERROR: ERROR: FragmentIO: could not open file aaT0586.9mers ERROR:: Exit from: ......srccorefragmentFragmentIO.cc line: 233 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish |
|
Scasc Send message Joined: 17 Aug 06 Posts: 2 Credit: 597,247 RAC: 0 |
Confirmed graphic bug fixed by 3.20. |
|
svincent Send message Joined: 30 Dec 05 Posts: 219 Credit: 12,120,035 RAC: 0 |
Computation failure with task 476693202 on Mac OS X 10.6 Setting database description ... Setting up checkpointing ... Setting up graphics native ... EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3 ERROR: core::util::switch_to_residue_type_set fails ERROR:: Exit from: src/core/util/SwitchResidueTypeSet.cc line: 143 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish </stderr_txt> ]]> Similar failures with tasks 476693175, 476692528, 476692356 |
[VENETO] bobovizSend message Joined: 1 Dec 05 Posts: 2172 Credit: 13,247,810 RAC: 7,905 |
477906814 Unpacking WU data ... Unpacking data: ../../projects/boinc.bakerlab.org_rosetta/T6211_nonlocal_boinc_input.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... Unhandled Exception Detected... - Unhandled Exception Record - Reason: Out Of Memory (C++ Exception) (0xe06d7363) at address 0x76B5B9BC Engaging BOINC Windows Runtime Debugger... |
|
edikl Send message Joined: 16 Jun 10 Posts: 10 Credit: 186,187 RAC: 0 |
Initialization complete. Setting WU description ... Unpacking zip data: ../../projects/boinc.bakerlab.org_rosetta/minirosetta_database_rev46858.zip Setting database description ... Setting up checkpointing ... Setting up graphics native ... EFPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALME can not find a residue type that matches the residue PRO_p:pro_hydroxylated_case1at position 3 ERROR: core::util::switch_to_residue_type_set fails ERROR:: Exit from: ......srccoreutilSwitchResidueTypeSet.cc line: 143 BOINC:: Error reading and gzipping output datafile: default.out called boinc_finish https://boinc.bakerlab.org/rosetta/workunit.php?wuid=435881534 |
|
bevjo01 Send message Joined: 24 Nov 05 Posts: 3 Credit: 130,799 RAC: 0 |
I was wondering if anyone else is experiencing this problem with the screen saver in version 3.20? I'm participating in several projects including R@H. Sometimes the BOINC client screen saver will present a message during transition to a different project "BOINC has experienced an unknown problem". Then instead of presenting the R@H screen saver I see a blank screen and two icons on the task bar. One of the icons appears to be "Rosetta-like" but there's nothing to identify it as such. The other icon is clearly the BOINC client. The odd thing is that at other times the R@H screen saver presents ok. So I'm wondering if there might be a problem at different phases of processing the WU or something else. All of the other projects I'm running seem to present ok. I haven't noticed any issues during the transition for anything else. I'm running Windows 7 Home Professional on a vanilla Intel desktop. Is there a log file that I can enable for R@H (as opposed to the BOINC Event log) that might help me get better data for you? JohnB |
robertmilesSend message Joined: 16 Jun 08 Posts: 1264 Credit: 14,421,737 RAC: 0 |
I was wondering if anyone else is experiencing this problem with the screen saver in version 3.20? Under Windows Vista, I have noticed that the 3.20 graphics are slow to start up, but then work properly. |
|
Mad_Max Send message Joined: 31 Dec 09 Posts: 209 Credit: 30,508,892 RAC: 1,179 |
Some of my teammembers get strange logs with multiple(hundreds) entries "attaching viewers!!!!" For example: https://boinc.bakerlab.org/rosetta/result.php?resultid=478117036 https://boinc.bakerlab.org/rosetta/result.php?resultid=478119708 https://boinc.bakerlab.org/rosetta/result.php?resultid=478119105 What does this mean? Just not remove some debugging information or is it some sort of errors at work? |
Message boards :
Number crunching :
Minirosetta 3.20
©2026 University of Washington
https://www.bakerlab.org