Message boards : Number crunching : Minirosetta 3.46
Previous · 1 · 2 · 3 · 4 · Next
| Author | Message |
|---|---|
|
Brian Priebe Send message Joined: 27 Nov 09 Posts: 16 Credit: 33,020,247 RAC: 0 |
minirosetta is updated to 3.46 to include recent developments in electron density and other scoring functions.Are there any particular minimum requirements for this version? Despite resetting the project, I am still getting only 3.45 jobs on a 6.x version of BOINC. |
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
Another that one erred after 28min. https://boinc.bakerlab.org/rosetta/workunit.php?wuid=525210001 rb_04_24_37778_72771__t000__2_C1_SAVE_ALL_OUT_IGNORE_THE_REST_79247_1030_0 # cpu_run_time_pref: 21600 dof_atom1 atomno= 3 rsd= 2 atom1 atomno= 1 rsd= 2 atom2 atomno= 2 rsd= 2 atom3 atomno= 5 rsd= 2 atom4 atomno= 6 rsd= 2 THETA1 nan THETA3 nan PHI2 0 ERROR: AtomTree::torsion_angle_dof_id: angle range error ERROR:: Exit from: src/core/kinematics/AtomTree.cc line: 780 SIGSEGV: segmentation violation Stack trace (17 frames): [0xb2aef87] [0xf7703400] [0xa166837] [0xa1f3edc] [0xa1f4e3c] [0x996c8d6] [0x996df60] [0x89561af] [0x867d35e] [0x992d14f] [0x9931429] [0x9aebcad] [0x9b4f815] [0x9b4d045] [0x8054950] [0xb33f328] [0x8048131] Exiting... </stderr_txt> ]]>
|
[VENETO] bobovizSend message Joined: 1 Dec 05 Posts: 2154 Credit: 12,909,431 RAC: 3,485 |
Despite resetting the project, I am still getting only 3.45 jobs on a 6.x version of BOINC. Still here, on 7.0.x version on boinc Only 3.45.... |
robertmilesSend message Joined: 16 Jun 08 Posts: 1263 Credit: 14,421,737 RAC: 0 |
minirosetta is updated to 3.46 to include recent developments in electron density and other scoring functions.Are there any particular minimum requirements for this version? Despite resetting the project, I am still getting only 3.45 jobs on a 6.x version of BOINC. The best I can tell, only the cryo workunits need the new features of 3.46. |
|
Brian Priebe Send message Joined: 27 Nov 09 Posts: 16 Credit: 33,020,247 RAC: 0 |
The best I can tell, only the cryo workunits need the new features of 3.46. Yet on BOINC 7.0.28 under Windows 7 (64-bit), all work units are delivered to run under Mini Rosetta app 3.46. Such is not the case under BOINC 6.12.33 running under Windows 2003 Server (32-bit): they all still run app 3.45. And of course the "cryo" series are still bombing out under 3.45. |
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
The best I can tell, only the cryo workunits need the new features of 3.46. Hi. For whatever reason windows 32 hasn't been updated, see the app page. Windows/x86 3.45 14 Nov 2012 19:40:42 UTC
|
|
Yifan Song Volunteer moderator Project developer Project scientist Send message Joined: 26 May 09 Posts: 62 Credit: 7,322 RAC: 0 |
OK, I got it wrong earlier. The Windows/x86 version is for the actual application, not the graphics. For some reason that file didn't get updated the last time I ran the script. I just reran the update, and it looks ok now. I didn't even think that would be the problem. Sorry about the confusion. |
Yuriy NaydenovSend message Joined: 17 Jun 12 Posts: 6 Credit: 5,009,678 RAC: 59 |
|
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
Hi. I haven't had error like this for a long time, it ran for over 5hrs. https://boinc.bakerlab.org/rosetta/workunit.php?wuid=525740466 CASP9_bw_benchmark_hybridization_run49_T0534_2_C1_SAVE_ALL_OUT_IGNORE_THE_REST_46345_6031_0 # cpu_run_time_pref: 21600 Client error___Compute error___18,861.34 <core_client_version>7.0.27</core_client_version> <![CDATA[ <message> Maximum disk usage exceeded </message> <stderr_txt>
|
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
This thing had ran for over 9hrs, 40min without a check point, so when I restarted the rig this morning it went back to the 0/start again so I've aborted it. endo_ab_Pan927.run.12_SAVE_ALL_OUT_IGNORE_THE_REST_79957_24_0 https://boinc.bakerlab.org/rosetta/workunit.php?wuid=526157680 ============================= Also another one of these. rb_04_24_37778_72771__t000__1_C1_SAVE_ALL_OUT_IGNORE_THE_REST_79247_1579_1 https://boinc.bakerlab.org/rosetta/workunit.php?wuid=525205524 <core_client_version>7.0.27</core_client_version> <![CDATA[ <message> Maximum disk usage exceeded </message> <stderr_txt>
|
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
I'm getting sick of this, over 10hrs run time then this Not impressed at all. If the watchdog killed it, why didn't it do so earlier? cryo_bg__chain_d_l_subrun_003_SAVE_ALL_OUT_IGNORE_THE_REST_79148_309_1 https://boinc.bakerlab.org/rosetta/workunit.php?wuid=524912436 # cpu_run_time_pref: 21600 BOINC:: CPU time: 36259.9s, 14400s + 21600s[2013- 5- 7 14:35:29:] :: BOINC InternalDecoyCount: 45 ====================================================== DONE :: 2 starting structures 36259.9 cpu seconds This process generated 45 decoys from 45 attempts ====================================================== called boinc_finish SIGSEGV: segmentation violation </stderr_txt> ]]> Validate state Invalid Claimed credit 373.059569535114 Granted credit 0 application version 3.46
|
|
Yifan Song Volunteer moderator Project developer Project scientist Send message Joined: 26 May 09 Posts: 62 Credit: 7,322 RAC: 0 |
I've been running debugging from my side for the last week on the same set of jobs, it's running a lot slower with the debug mode, so I haven't consistently reproduce the seg fault yet. My suspicion is that something is still not quite fixed in the gradient calculations. |
robertmilesSend message Joined: 16 Jun 08 Posts: 1263 Credit: 14,421,737 RAC: 0 |
I'm getting sick of this, over 10hrs run time then this Not impressed at all. Looks like you might get more useful results if you decrease the allowed runtime for your workunits enough that they won't run over 10 hours. |
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
I don't know what I've done to deserve these things, got'a love that credit for 8hrs work. rb_05_07_37484_73467__t000__1_C1_SAVE_ALL_OUT_IGNORE_THE_REST_80583_498_0 https://boinc.bakerlab.org/rosetta/workunit.php?wuid=526810531 Starting watchdog... Watchdog active. # cpu_run_time_pref: 14400 BOINC:: CPU time: 28814.8s, 14400s + 14400s[2013- 5- 9 15:34:10:] :: BOINC InternalDecoyCount: 3 ====================================================== DONE :: 2 starting structures 28814.8 cpu seconds This process generated 3 decoys from 3 attempts ====================================================== called boinc_finish SIGSEGV: segmentation violation Stack trace (21 frames): [0xb2aef87] [0xf7745400] [0xa6ce54c] [0xa6e7659] [0xa1648c7] [0xa1f2dd2] [0xa1f4df1] [0x9d4d1a5] [0x9f10187] [0x9d56457] [0x9d4265a] [0x8925eca] [0x8681018] [0x992d14f] [0x9931429] [0x9aebcad] [0x9b4f815] [0x9b4d045] [0x8054950] [0xb33f328] [0x8048131] Exiting... </stderr_txt> ]]> Validate state__Valid Claimed credit__222.194343136291 Granted credit__7.33239552472893 application version__3.46
|
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
Something odd with these new tasks, showing 0 for everything but are valid. Both ran for longer then runtime shown, they went back when restarted & they both ran for over 7hrs. idealdead2_test_abrelax_nohoms_1l9l_SAVE_ALL_OUT_80619_74_0 https://boinc.bakerlab.org/rosetta/workunit.php?wuid=526963404 # cpu_run_time_pref: 14400 ====================================================== DONE :: 0 starting structures 11822.6 cpu seconds This process generated 0 decoys from 0 attempts ====================================================== BOINC :: WS_max 0 BOINC :: Watchdog shutting down... BOINC :: BOINC support services shutting down cleanly ... called boinc_finish </stderr_txt> ]]> Validate state Valid Claimed credit 91.1614143589971 Granted credit 125.885524056059 application version 3.46 ============================================== idealdead2_test_abrelax_homs_1l9l_SAVE_ALL_OUT_80618_77_0 https://boinc.bakerlab.org/rosetta/workunit.php?wuid=526964451 # cpu_run_time_pref: 14400 ====================================================== DONE :: 0 starting structures 3917.32 cpu seconds This process generated 0 decoys from 0 attempts ====================================================== BOINC :: WS_max 0 BOINC :: Watchdog shutting down... BOINC :: BOINC support services shutting down cleanly ... called boinc_finish </stderr_txt> ]]> Validate state Valid Claimed credit 40.3030670421785 Granted credit 43.9948759779241 application version 3.46
|
ChileanSend message Joined: 16 Oct 05 Posts: 711 Credit: 26,694,507 RAC: 0 |
I got a bunch of WUs that failed after hours of crunching (from different machines): https://boinc.bakerlab.org/rosetta/result.php?resultid=580361643 https://boinc.bakerlab.org/rosetta/result.php?resultid=580450964 https://boinc.bakerlab.org/rosetta/result.php?resultid=580286623 https://boinc.bakerlab.org/rosetta/result.php?resultid=580286646
|
|
P . P . L . Send message Joined: 20 Aug 06 Posts: 581 Credit: 4,865,274 RAC: 0 |
Another one of these died, after 4sec's. idealdead2_test_abrelax_nohoms_1jf8_SAVE_ALL_OUT_80619_456_0 https://boinc.bakerlab.org/rosetta/workunit.php?wuid=527126051 Setting database description ... Setting up checkpointing ... Setting up graphics native ... DKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLRX can not find a residue type that matches the residue Kat position 131 ERROR: core::util::switch_to_residue_type_set fails ERROR:: Exit from: src/core/util/SwitchResidueTypeSet.cc line: 143 std::cerr: Exception was thrown: [ERROR] EXCN_utility_exit has been thrown from: src/core/util/SwitchResidueTypeSet.cc line: 143 ERROR: core::util::switch_to_residue_type_set fails </stderr_txt> ]]>
|
|
Yifan Song Volunteer moderator Project developer Project scientist Send message Joined: 26 May 09 Posts: 62 Credit: 7,322 RAC: 0 |
Thanks! I'll let the person running the idealdead2 jobs know about this. -y |
robertmilesSend message Joined: 16 Jun 08 Posts: 1263 Credit: 14,421,737 RAC: 0 |
A workunit that may have a problem: https://boinc.bakerlab.org/rosetta/workunit.php?wuid=527210644 another idealdead2 workunit Now at 15:51:54 elapsed, even though I've set 12 hours as the workunit length for my computers. Showing 98.956% progress, slowly increasing. Remaining time shown as 00:10:03 and NOT decreasing. No error messages visible. I'll let it go to at least 16 hours before deciding if I should abort it. |
robertmilesSend message Joined: 16 Jun 08 Posts: 1263 Credit: 14,421,737 RAC: 0 |
A workunit that may have a problem: It finished in a little more than 16 hours, and was declared a success. However, several dozen of these errors in the output: sin_cos_range ERROR: 1.#QNAN00 is outside of [-1,+1] sin and cos value legal range Also around 20 NaN errors. |
Message boards :
Number crunching :
Minirosetta 3.46
©2026 University of Washington
https://www.bakerlab.org